PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G224200.1.p
Common NameLOC101760025, SETIT_002871mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 189aa    MW: 20259.5 Da    PI: 6.8029
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G224200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.48.1e-151046541
                 TCR  5 gCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                        +CnCkk+ Clk+YC+Cf+ + +Cs+ C+C++C N+e+
  Seita.5G224200.1.p 10 SCNCKKTTCLKRYCQCFQGEFFCSSACNCKGCWNRED 46
                        7*********************************986 PP

2TCR46.66.8e-1579117240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         + kgC+C+ks C+k+YCeCf++++ C+ +CkC++C+N++
  Seita.5G224200.1.p  79 HVKGCTCNKSGCKKNYCECFKKKVACTTRCKCQGCENSH 117
                         789**********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-10647IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163425.6147118IPR005172CRC domain
PfamPF036386.3E-111044IPR005172CRC domain
SMARTSM011141.3E-1078119IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.1E-1181116IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MNQDEEPRPS CNCKKTTCLK RYCQCFQGEF FCSSACNCKG CWNREDRRTF VEEHAELRLN  60
TKPGVLSKDI AVTGEKRSHV KGCTCNKSGC KKNYCECFKK KVACTTRCKC QGCENSHGTG  120
GKGLQENGDP GGPSGNPNEA PDGGDGSPGV SNESAVVTDE DLPGPTEAEW SLQGVLLHDN  180
ANSTLQGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969151.11e-130PREDICTED: protein tesmin/TSO1-like CXC 3
TrEMBLK3XLU81e-130K3XLU8_SETIT; Uncharacterized protein
STRINGSi002871m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122672336
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.17e-22Tesmin/TSO1-like CXC domain-containing protein